Proteintech, 13188-1-AP, CLEC2D Polyclonal antibody

Size: 20ul / 150ul The CLEC2D (13188-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC2D in WB, ELISA applications with reactivity to human samples 13188-1-AP targets CLEC2D in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Jurkat cells, Saos-2 cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information CLEC2D (C-type lectin domain family 2 member D), also known as LLT1 (lectin-like transcript 1) or OCIL (Osteoclast inhibitory lectin), is a single-pass type II membrane protein expressed by hematopoietic cells and osteoblasts (PMID: 21930700; 14753741). Its expression was found to be tightly correlated with activation on T cells, NK cells, B cells, and DCs (PMID: 21930700). CLEC2D is a ligand for the human NKR-P1A (CD161) receptor and their interaction differentially regulates NK- and T-cell functions (PMID: 16339513, 16339512). It inhibits the formation and function of osteoclasts and modulates the release of interferon-gamma by human NK cells (PMID:14753741; 20415786). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3862 Product name: Recombinant human CLEC2D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC019883 Sequence: MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ Predict reactive species Full Name: C-type lectin domain family 2, member D Calculated Molecular Weight: 154 aa, 18 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC019883 Gene Symbol: CLEC2D Gene ID (NCBI): 29121 RRID: AB_2877920 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHP7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.