Proteintech, 13192-1-AP, SAA Polyclonal antibody

Size: 20ul / 150ul The SAA (13192-1-AP) by Proteintech is a Polyclonal antibody targeting SAA in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 13192-1-AP targets SAA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: serum from mouse injected with bacteria Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Human SAA proteins are a group of apolipoproteins mainly found in the high density lipoprotein (HDL) portion of plasma. The serum amyloid A (SAA) protein is an acute phase apolipoprotein reactant produced mainly by hepatocytes and under the regulation of inflammatory cytokines(PMID: 12011456). Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA2 protein(PMID: 1463770). This antibody can recognize SAA1 and SAA2. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3869 Product name: Recombinant human SAA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC020795 Sequence: MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY Predict reactive species Full Name: serum amyloid A2 Calculated Molecular Weight: 122 aa, 14 kDa Observed Molecular Weight: 12-13 kDa GenBank Accession Number: BC020795 Gene Symbol: SAA2 Gene ID (NCBI): 6289 RRID: AB_2877923 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0DJI9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.