Iright
BRAND / VENDOR: Proteintech

Proteintech, 13202-1-AP, SOAT1/ACAT1 Polyclonal antibody

CATALOG NUMBER: 13202-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SOAT1/ACAT1 (13202-1-AP) by Proteintech is a Polyclonal antibody targeting SOAT1/ACAT1 in WB, ELISA applications with reactivity to human, mouse, rat samples 13202-1-AP targets SOAT1/ACAT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HuH-7 cells, SW480 cells, THP-1 cells, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Sterol O-acyltransferase 1 (SOAT1/ACAT1) catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol (PubMed:16154994,16647063, 32433614, 32944968). It plays a role in lipoprotein assembly and dietary cholesterol absorption (PubMed:16154994, 9020103). SOAT1 has three isoforms with molecular weights of 65, 58, and 57 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3944 Product name: Recombinant human SOAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-326 aa of BC028940 Sequence: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMK Predict reactive species Full Name: sterol O-acyltransferase 1 Calculated Molecular Weight: 550 aa, 65 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC028940 Gene Symbol: SOAT1/ACAT1 Gene ID (NCBI): 6646 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35610 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924