Proteintech, 13204-1-AP, WFDC1 Polyclonal antibody

Size: 20ul / 150ul The WFDC1 (13204-1-AP) by Proteintech is a Polyclonal antibody targeting WFDC1 in WB, IHC, ELISA applications with reactivity to human samples 13204-1-AP targets WFDC1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, PC-3 cells Positive IHC detected in: human breast cancer tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3960 Product name: Recombinant human WFDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-220 aa of BC029159 Sequence: ALPARLAEKSRAEEAGAPGGPRQPRADRCPPPPRTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ Predict reactive species Full Name: WAP four-disulfide core domain 1 Calculated Molecular Weight: 220 aa, 24 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC029159 Gene Symbol: WFDC1 Gene ID (NCBI): 58189 RRID: AB_2215895 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HC57 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.