Proteintech, 13207-1-AP, CKMT2 Polyclonal antibody

Size: 20ul / 150ul The CKMT2 (13207-1-AP) by Proteintech is a Polyclonal antibody targeting CKMT2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13207-1-AP targets CKMT2 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, human heart tissue, human skeletal muscle tissue, mouse skeletal muscle tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: H9C2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:8000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CKMT2 (Creatine kinase S-type, mitochondrial), also known as s-MtCK, is one of the creatine kinase (CK) isozymes that are tightly coupled to adenosine triphosphate (ATP) output via adenine nucleotide transport proteins or carriers, making it an important player in ATP synthesis and respiratory chain activity (PMID: 38172162). Enhancing Ckmt2 expression or activity can protect against myocardial injury caused by ischemia-reperfusion injury (PMID: 39457679). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3971 Product name: Recombinant human CKMT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 57-419 aa of BC029140 Sequence: LRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK Predict reactive species Full Name: creatine kinase, mitochondrial 2 (sarcomeric) Calculated Molecular Weight: 419 aa, 48 kDa Observed Molecular Weight: 41-48 kDa GenBank Accession Number: BC029140 Gene Symbol: CKMT2 Gene ID (NCBI): 1160 RRID: AB_2081188 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17540 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.