Iright
BRAND / VENDOR: Proteintech

Proteintech, 13210-1-AP, PPP3R1 Polyclonal antibody

CATALOG NUMBER: 13210-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PPP3R1 (13210-1-AP) by Proteintech is a Polyclonal antibody targeting PPP3R1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13210-1-AP targets PPP3R1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HeLa cells, human stomach tissue, K-562 cells, rat brain tissue Positive IP detected in: HeLa cells Positive IHC detected in: mouse testis tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Protein phosphatase 3 (PPP3, formerly PP2B, Calcineurin), a serine/ threonine protein phosphatase, is a heterodimer composed of one catalytic subunit (PPP3C, Calcineurin A) and one regulatory subunit (PPP3R, Calcineurin B). PPP3R has two isoforms, PPP3R1 and PPP3R2. PPP3Rl is ubiquitously expressed in different tissues and is coded by the PPP3R1 gene which was mapped recently to human chromosome 2. PPP3Rl has four functional calcium-binding sites. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3992 Product name: Recombinant human PPP3R1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC027913 Sequence: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV Predict reactive species Full Name: protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform Calculated Molecular Weight: 170 aa, 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC027913 Gene Symbol: PPP3R1 Gene ID (NCBI): 5534 RRID: AB_2252760 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P63098 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924