Iright
BRAND / VENDOR: Proteintech

Proteintech, 13211-1-AP, UBA6 Polyclonal antibody

CATALOG NUMBER: 13211-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UBA6 (13211-1-AP) by Proteintech is a Polyclonal antibody targeting UBA6 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 13211-1-AP targets UBA6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, human brain tissue Positive IHC detected in: mouse testis tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information UBA6(Ubiquitin-like modifier-activating enzyme 6) is also named as MOP4, UBE1L2 and belongs to the ubiquitin-activating E1 family. It probably acts as a single molecule like UBE1 and not as a heterodimeric E1 complex, as formed by AOS1/Uba2 and APP-BP1/Uba3. UBA6 is even more restricted in distribution because it is only found in vertebrates but not in lower organisms so that it might have a specialized role in tissues of higher organisms, and in particular, in the testis, where it is expressed by far most abundantly.(PMID:17580310). It has 4 isoforms produced by alternative splicing. This antibody recognizes the full-length(118 kda) and the truncated isoform CRA_b (60-70 kDa) of UBA6 (NCBI). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4000 Product name: Recombinant human UBA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 87-389 aa of BC031637 Sequence: AVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY Predict reactive species Full Name: ubiquitin-like modifier activating enzyme 6 Calculated Molecular Weight: 1052 aa, 118 kDa Observed Molecular Weight: 118 kDa GenBank Accession Number: BC031637 Gene Symbol: UBA6 Gene ID (NCBI): 55236 RRID: AB_2211747 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A0AVT1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924