Iright
BRAND / VENDOR: Proteintech

Proteintech, 13224-1-AP, LRG1 Polyclonal antibody

CATALOG NUMBER: 13224-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LRG1 (13224-1-AP) by Proteintech is a Polyclonal antibody targeting LRG1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 13224-1-AP targets LRG1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human plasma Positive IHC detected in: mouse liver tissue, human liver tissue, human liver cancer tissue, human pancreas cancer tissue, mouse brain tissue, mouse pancreas tissue, mouse prostate tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information LRG1, also known as LRG, is a member of the leucine-rich repeat (LRR) family of proteins, containing eight LRR (leucine-rich) repeats and one LRRCT domain. The gene of LRG1 maps to chromosome 19p13.3, and encodes a 347-amino acid protein with a predicted unmodified molecular weight of 38 kD. The mature form of LRG1 is a secreted glycoprotein which has 312 amino acids and an experimentally determined molecular mass of 45 kD. The LRR family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation. Levels of the LRG protein are markedly elevated in acute appendicitis and therefore could be used as a diagnostic aid. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3964 Product name: Recombinant human LRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-347 aa of BC034389 Sequence: DCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ Predict reactive species Full Name: leucine-rich alpha-2-glycoprotein 1 Calculated Molecular Weight: 347 aa, 38 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC034389 Gene Symbol: LRG1 Gene ID (NCBI): 116844 RRID: AB_2138714 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02750 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924