Iright
BRAND / VENDOR: Proteintech

Proteintech, 13247-1-AP, PI4KB Polyclonal antibody

CATALOG NUMBER: 13247-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PI4KB (13247-1-AP) by Proteintech is a Polyclonal antibody targeting PI4KB in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13247-1-AP targets PI4KB in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, NIH-3T3 cells (RNAi) Positive IP detected in: K-562 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: C6 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PI4KB(phosphatidylinositol 4-kinase beta) is also named as PIK4CB, NPIK, PI4K92 and belongs to the PI3/PI4-kinase family. It may regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation and involved in Golgi-to-plasma membrane trafficking. PI4KB is a type III enzyme that is sensitive to wortmannin(PMID:9020160). This protein has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3989 Product name: Recombinant human PI4KB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 449-801 aa of BC040300 Sequence: IGELQVELPEVHTNSCDNISQFSVDSITSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKEPWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM Predict reactive species Full Name: phosphatidylinositol 4-kinase, catalytic, beta Calculated Molecular Weight: 801 aa, 90 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC040300 Gene Symbol: PI4KB Gene ID (NCBI): 5298 RRID: AB_2252370 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBF8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924