Proteintech, 13285-1-AP, ZBP1 Polyclonal antibody

Size: 20ul / 150ul The ZBP1 (13285-1-AP) by Proteintech is a Polyclonal antibody targeting ZBP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 13285-1-AP targets ZBP1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells Positive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ZBP1(Z-DNA-binding protein 1), also named as DAI or DLM-1, is a nucleic acid sensor with some isoforms. It has been reported that ZBP1 can sense the viral nucleic acids of viruses and induce the death of infected cells to prevent virus transmission. ZBP1 can be activated and causes necrocytosis without viral infection, which is associated with nuclear Z-form nucleic acids. ZBP1 can be detected 42 kDa, 55 kDa, 68 kDa isoforms (PMID: 37012234, PMID: 9121465). Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4119 Product name: Recombinant human ZBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-149 aa of BC028218 Sequence: MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPGNCHPGEAGLTLQGASWQWTSTDLSLGSNLNSATWELTGFLSLCLGFFFWLMELTAGLLGRGC Predict reactive species Full Name: Z-DNA binding protein 1 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 42-68 kDa GenBank Accession Number: BC028218 Gene Symbol: ZBP1 Gene ID (NCBI): 81030 RRID: AB_2122651 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H171 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.