Iright
BRAND / VENDOR: Proteintech

Proteintech, 13287-1-AP, IL-12RB1/CD212 Polyclonal antibody

CATALOG NUMBER: 13287-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IL-12RB1/CD212 (13287-1-AP) by Proteintech is a Polyclonal antibody targeting IL-12RB1/CD212 in WB, IHC, IP, ELISA applications with reactivity to human samples 13287-1-AP targets IL-12RB1/CD212 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, Jurkat cells Positive IP detected in: K-562 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information IL12RB1, also named as Interleukin-12 receptor subunit beta-1 or CD212, is a 662 amino acid protein, which contains 5 fibronectin type-III domains and belongs to the type I cytokine receptor family. Type 2 subfamily. IL12RB1 localizes in the membrane and functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade. Specification Tested Reactivity: human Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3983 Product name: Recombinant human IL-12RB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-381 aa of BC029121 Sequence: CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTDGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF Predict reactive species Full Name: interleukin 12 receptor, beta 1 Calculated Molecular Weight: 662 aa, 73 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC029121 Gene Symbol: IL12RB1 Gene ID (NCBI): 3594 RRID: AB_2124039 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42701 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924