Iright
BRAND / VENDOR: Proteintech

Proteintech, 13295-1-AP, Cyclin A1 Polyclonal antibody

CATALOG NUMBER: 13295-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Cyclin A1 (13295-1-AP) by Proteintech is a Polyclonal antibody targeting Cyclin A1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13295-1-AP targets Cyclin A1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CCNA1 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. CCNA1 binds both CDK2 and CDC2 kinases, which give two distinct kinase activities, one appearing in S phase, the other in G2, and thus regulate separate functions in cell cycle. CCNA1 was found to bind to important cell cycle regulators, such as Rb family proteins, transcription factor E2F-1, and the p21 family proteins. In general, the expression of CCNA1 is tissue-specific and high CCNA1 expression is limited to testis; besides, lower levels of CCNA1 expression are also observed in other human cell lines and in healthy brain. Currently, CCNA1 expression has been illustrated to be downregulated in various tumors, including head and neck squamous-cell cancer (HNSCC) and nasopharyngeal carcinoma; and the promoter of the CCNA1 gene is found to be frequently methylated in colon cancer and HNSCC. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4005 Product name: Recombinant human CCNA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-465 aa of BC036346 Sequence: GTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ Predict reactive species Full Name: cyclin A1 Calculated Molecular Weight: 464 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC036346 Gene Symbol: Cyclin A1 Gene ID (NCBI): 8900 RRID: AB_2071993 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78396 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924