Iright
BRAND / VENDOR: Proteintech

Proteintech, 13303-1-AP, VASH2 Polyclonal antibody

CATALOG NUMBER: 13303-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VASH2 (13303-1-AP) by Proteintech is a Polyclonal antibody targeting VASH2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 13303-1-AP targets VASH2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HUVEC cells, BxPC-3 cells, L02 cells, SW 1990 cells, PANC-1 cells, PC-12 cells Positive IHC detected in: human stomach cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information VASH2, also named as vasohibin 2, is an important pro-angiogenesis factor in solid tumor. It has been reported that VASH2 is expressed in mononuclear cells mobilized from bone marrow to promote angiogenesis. VASH2 also plays a key role in axon formation. VASH2 is localized as a nuclear type(with 311 amino acid residues) and cytoplasmic type (with 355 amino acid residues and low abundance). Cytoplasmic VASH2 is associated with carcinoma angiogenesis, while nuclear VASH2 may be associated with cell proliferation. This antibody recognizes both the nuclear and cytoplasmic isoforms.(PMID:23615928; 19204325; 31235911; 26177649) Specification Tested Reactivity: human, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4121 Product name: Recombinant human VASH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-156 aa of BC028194 Sequence: METAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKGLCSH Predict reactive species Full Name: vasohibin 2 Calculated Molecular Weight: 355 aa, 40 kDa Observed Molecular Weight: 30-34 kDa GenBank Accession Number: BC028194 Gene Symbol: VASH2 Gene ID (NCBI): 79805 RRID: AB_10642836 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86V25 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924