Iright
BRAND / VENDOR: Proteintech

Proteintech, 13309-1-AP, GHRL Polyclonal antibody

CATALOG NUMBER: 13309-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GHRL (13309-1-AP) by Proteintech is a Polyclonal antibody targeting GHRL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13309-1-AP targets GHRL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human stomach tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:600-1:2400 Background Information GHRL encodes ghrelin-obestatin preproprotein, which generates ghrelin and obestatin. Ghrelin is predominantly produced in endocrine cells in the gastric mucosa, called X/A-like or ghrelin cells, from where it is secreted into the plasma. In the pituitary gland, ghrelin stimulates GH release and regulates food intake and energy metabolism. Obestatin was initially reported to be an endogenous ligand for the orphan G protein-coupled receptor GPR39 and was involved in satiety and decreased food intake; however, these findings are controversial. Recent reports show that obestatin is involved in inhibiting thirst and anxiety, improving memory, regulating sleep, affecting cell proliferation, and increasing the secretion of pancreatic juice enzymes. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4141 Product name: Recombinant human GHRL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-117 aa of BC025791 Sequence: LSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK Predict reactive species Full Name: ghrelin/obestatin prepropeptide Calculated Molecular Weight: 117 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC025791 Gene Symbol: GHRL Gene ID (NCBI): 51738 RRID: AB_2294726 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBU3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924