Proteintech, 13317-1-AP, Cytoglobin Polyclonal antibody

Size: 20ul / 150ul The Cytoglobin (13317-1-AP) by Proteintech is a Polyclonal antibody targeting Cytoglobin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13317-1-AP targets Cytoglobin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, human heart tissue, human uterus tissue, mouse brain tissue, mouse kidney tissue, mouse lung tissue, mouse small intestine tissue, mouse spleen tissue, mouse stomach tissue, PC-3 cells, rat kidney tissue, Transfected HEK-293 cells Positive IHC detected in: human liver cancer tissue, human heart tissue, human liver tissue, human prostate cancer tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Cytoglobin, also named as Histoglobin, HGb, STAP and CYGB, belongs to the globin family. Cytoglobin may have a protective function during conditions of oxidative stress. It may be involved in intracellular oxygen storage or transfer. It serves as a defensive mechanism against oxidative stress both in vitro and in vivo.(PMID:21224051) Cytoglobin is a ubiquitously expressed hexacoordinate hemoglobin that may facilitate diffusion of oxygen through tissues. The protein, with calculated MW of 21 kd, runs as a 29kd one in canine retina, kidney, liver, lung, and heart. It may be caused by posttranslational modification of the protein. Various immuno-staining patterns were reported including nuclear, cytoplasm and extracellular location. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4161 Product name: Recombinant human CYGB protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-190 aa of BC029798 Sequence: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP Predict reactive species Full Name: cytoglobin Calculated Molecular Weight: 190 aa, 21 kDa Observed Molecular Weight: 21-29 kDa GenBank Accession Number: BC029798 Gene Symbol: Cytoglobin Gene ID (NCBI): 114757 RRID: AB_2090645 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWM9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.