Proteintech, 13330-1-AP, BUB1 Polyclonal antibody

Size: 20ul / 150ul The BUB1 (13330-1-AP) by Proteintech is a Polyclonal antibody targeting BUB1 in WB, IF/ICC, ELISA applications with reactivity to human, canine samples 13330-1-AP targets BUB1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, canine samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells Positive IF/ICC detected in: IMR-90 cells, MDCK cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Bub1 is an evolutionarily conserved mitotic checkpoint control protein that is present in diverse organisms including yeast and humans. Bub1 is a serine/threonine protein kinase and is required for recruitment of Mad1, Mad2, Bub3, and CENP-E to kinetochores. Full-length Bub1 protein was cleaved to an 45 kDa fragment and an intermediate fragment of 90 kDa, only detected at early stages of apoptosis execution, indicating cleavage of Bub1 in the amino- and carboxy-terminal regions of the protein(PMID:15818396). Specification Tested Reactivity: human, canine Cited Reactivity: human, carassius auratus Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4138 Product name: Recombinant human BUB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 785-1083 aa of BC028201 Sequence: KLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCETSGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRS Predict reactive species Full Name: budding uninhibited by benzimidazoles 1 homolog (yeast) Calculated Molecular Weight: 1085 aa, 122 kDa Observed Molecular Weight: 45 kDa, 120 kDa GenBank Accession Number: BC028201 Gene Symbol: BUB1 Gene ID (NCBI): 699 RRID: AB_2814999 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43683 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.