Iright
BRAND / VENDOR: Proteintech

Proteintech, 13342-1-AP, CA5B Polyclonal antibody

CATALOG NUMBER: 13342-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CA5B (13342-1-AP) by Proteintech is a Polyclonal antibody targeting CA5B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13342-1-AP targets CA5B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information CA5B(Carbonic anhydrase 5B, mitochondrial) is also named as CA-VB and belongs to the alpha-carbonic anhydrase family.CA5B encodes a 317-amino acid protein that has 64% sequence similarity with CA5 (114761), a mitochondrial CA, and contains a 33-amino-acid residue signal sequence. Western blot analysis revealed a 36-kD protein precursor and a 32-kD mature protein(PMID:10409679). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4166 Product name: Recombinant human CA5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-317 aa of BC028142 Sequence: MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP Predict reactive species Full Name: carbonic anhydrase VB, mitochondrial Calculated Molecular Weight: 317 aa, 36 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC028142 Gene Symbol: CA5B Gene ID (NCBI): 11238 RRID: AB_2243612 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2D0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924