Proteintech, 13358-1-AP, RAD17 Polyclonal antibody

Size: 20ul / 150ul The RAD17 (13358-1-AP) by Proteintech is a Polyclonal antibody targeting RAD17 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 13358-1-AP targets RAD17 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, Raji cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4171 Product name: Recombinant human RAD17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 421-670 aa of BC032304 Sequence: LVEPEEVVEMSHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWNTRSLLREYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENCLAAKALFPDFCLPALCRQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEALTDREHGMIDPDSGDEAQLNGGHSAEESLGEPTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT Predict reactive species Full Name: RAD17 homolog (S. pombe) Calculated Molecular Weight: 681 aa, 71 kDa Observed Molecular Weight: 71 kDa GenBank Accession Number: BC032304 Gene Symbol: RAD17 Gene ID (NCBI): 5884 RRID: AB_2269268 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75943 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.