Proteintech, 13365-1-AP, NAT10 Polyclonal antibody

Size: 20ul / 150ul The NAT10 (13365-1-AP) by Proteintech is a Polyclonal antibody targeting NAT10 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 13365-1-AP targets NAT10 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Calu-1 cells, HEK-293 cells, NIH/3T3 cells Positive IP detected in: HEK-293 cells, mouse testis tissue Positive IHC detected in: human ovary cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information NAT10 (N-acetyltransferase 10) is a nucleolar protein that is involved in regulation of telomerase activity, DNA damage response, and cytokinesis. It also plays a role in maintaining nuclear shape. Inhibition of NAT10 has been reported to rescue the misshapen nuclei in laminopathic cells via microtubule reorganization. NAT10 is the first enzyme to be found to catalyze ac4C production in eukaryotic RNA and has acetyltransferase activity and RNA-binding activity. (PMID: 23592795). NAT10 is the singular human enzyme to have both acetyltransferase and RNA binding activities (PMID: 30449621). NAT10 is associated with U3 small nucleolar RNA and acetylates upstream binding factors to activate rRNA transcription (PMID: 21177859). NAT10 promoted cisplatin chemoresistance in bladder cancer cells by enhancing DNA damage repair (DDR) (PMID: 36939377). NAT10 is a vital member of the Gcn5-related N-acetyltransferase (GNAT) family and contains 1,025 amino acids with a molecular weight of 116 kDa (PMID: 37128278). NAT10 is commonly expressed in lymphoid tissue, kidney, liver, cerebellum, cerebral cortex, and the central nervous system during the embryonic period. Normal tissue cells express NAT10 in the nucleus, while tumor cells translocate NAT10 to the cytoplasm, nucleoplasm, and nuclear membrane, affecting tumor formation (PMID: 37128278). The specificity of this antibody has been tested by siRNA. (24786082) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, canine, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4184 Product name: Recombinant human NAT10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 676-1025 aa of BC035558 Sequence: EAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK Predict reactive species Full Name: N-acetyltransferase 10 (GCN5-related) Calculated Molecular Weight: 1025 aa, 116 kDa Observed Molecular Weight: 116 kDa GenBank Accession Number: BC035558 Gene Symbol: NAT10 Gene ID (NCBI): 55226 RRID: AB_2148944 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0A0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.