Iright
BRAND / VENDOR: Proteintech

Proteintech, 13367-1-AP, SPA17 Polyclonal antibody

CATALOG NUMBER: 13367-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SPA17 (13367-1-AP) by Proteintech is a Polyclonal antibody targeting SPA17 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 13367-1-AP targets SPA17 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human testis tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Sperm surface protein Sp17(SPA17)is a 151 amino acids protein (17kDa), which is a sperm surface peripheral membrane protein. It is a highly conserved mammalian protein expressed in developing spermatozoa and mature spermatids, and reported to play a role in the interaction of sperm with the zona pellucida. SP17 exists as a homodimer and localizes to the head and tail of spermatozoa. SP17 has been identified as a cancer/testis antigen and is expressed in ovarian cancer and multiple myeloma. This suggests that SP17 could be suitable as a target in tumor immunotherapy. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4186 Product name: Recombinant human SPA17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC032457 Sequence: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK Predict reactive species Full Name: sperm autoantigenic protein 17 Calculated Molecular Weight: 151 aa, 17 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC032457 Gene Symbol: SPA17 Gene ID (NCBI): 53340 RRID: AB_2194631 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15506 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924