Proteintech, 13369-1-AP, MYNN Polyclonal antibody

Size: 20ul / 150ul The MYNN (13369-1-AP) by Proteintech is a Polyclonal antibody targeting MYNN in WB, IHC, ELISA applications with reactivity to human, mouse samples 13369-1-AP targets MYNN in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, Caco-2 cells, mouse brain tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information Myoneurin (MYNN) gene locates on 3q26.2 and encodes a member of the BTB/POZ and zinc finger (ZF) domain-containing protein family that is involved in the control of gene expression. MYNN is widely expressed in various tissue types in mammals. MYNN has 4 isoforms with the molecular mass of 10, 57, 65-69 kDa. (PMID: 30120764) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4188 Product name: Recombinant human MYNN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 303-610 aa of BC033620 Sequence: MCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGEKPYKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGEKPYICGICGKSFISSGELNKHFRSHTGERPFICELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQDSIQKSPLSETMDVKPSDMTLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSEPQLIFLQQLY Predict reactive species Full Name: myoneurin Calculated Molecular Weight: 610 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC033620 Gene Symbol: MYNN Gene ID (NCBI): 55892 RRID: AB_2923559 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NPC7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.