Iright
BRAND / VENDOR: Proteintech

Proteintech, 13402-1-AP, CHD9 Polyclonal antibody

CATALOG NUMBER: 13402-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CHD9 (13402-1-AP) by Proteintech is a Polyclonal antibody targeting CHD9 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 13402-1-AP targets CHD9 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SGC-7901 cells, K-562 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CHD (chromodomain helicase DNA-binding) proteins are chromatin remodelling enzymes which reshape the local chromatin architecture to allow access to transcriptional machinery in a tissue-specific context. CHD proteins facilitate various stages of gene expression, including binding and recruiting transcription factors, histone modifications, and transcriptional elongation, termination and processing. CHD proteins are characterized by two tandem chromodomains and a helicase C domain, but also possesses additional functional domains which classify them into three subfamilies. CHD9 is active in mesenchymal stromal stem cells and osteoprogenitor cells, and is suggested to control osteogenic cell fate (PMID: 32295522). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4245 Product name: Recombinant human CHD9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC033770 Sequence: MTDPMMDFFDDANLFGETLEGLSDDAFVQPGPVSLVDELNLGAEFEPLHIDSLNHVQGTPTHQKMTDFEQLNQFDSIKFHHVNQSFGSPAEHVLSPHSQFNCSPIHPQNQPNGLFPDVSDGSPMWGHQTATTISNQNGSPFHQQGHSHSMHQNKSFVAHHDFALFQANEQQTQCTSLRSQQNRNNLNPGQNSLSQSKNFMNVSGPHRVNVNHPPQMTNASNSQQSISMQQFSQTSNPSAHFHKCSSHQEGNFNGPSPNMTSCSVSNSQQFSSHYSFSSNHISPNSLLQSSAVLASNHTNQTLSDFTGSNSFSPHRGIKQESTQHILNPNTSLNSNNFQILHSSHPQGNYS Predict reactive species Full Name: chromodomain helicase DNA binding protein 9 Calculated Molecular Weight: 2897 aa, 326 kDa Observed Molecular Weight: 330 kDa GenBank Accession Number: BC033770 Gene Symbol: CHD9 Gene ID (NCBI): 80205 RRID: AB_10640425 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3L8U1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924