Proteintech, 13407-1-AP, SLC19A3 Polyclonal antibody

Size: 20ul / 150ul The SLC19A3 (13407-1-AP) by Proteintech is a Polyclonal antibody targeting SLC19A3 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 13407-1-AP targets SLC19A3 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, SH-SY5Y cells, mouse skeletal muscle tissue, mouse kidney tissue, human placenta tissue, rat heart tissue, 3T3-L1 cells, rat liver tissue Positive IP detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4053 Product name: Recombinant human SLC19A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 188-315 aa of BC032014 Sequence: LFLPMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKRLFYWSLWWAFATAGFNQVLNYVQILWDYKAPSQDSSIY Predict reactive species Full Name: solute carrier family 19, member 3 Calculated Molecular Weight: 496 aa, 56 kDa Observed Molecular Weight: 63-70 kDa GenBank Accession Number: BC032014 Gene Symbol: SLC19A3 Gene ID (NCBI): 80704 RRID: AB_2187997 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BZV2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.