Iright
BRAND / VENDOR: Proteintech

Proteintech, 13412-1-AP, RAB27B Polyclonal antibody

CATALOG NUMBER: 13412-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RAB27B (13412-1-AP) by Proteintech is a Polyclonal antibody targeting RAB27B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13412-1-AP targets RAB27B in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat spleen tissue, A375 cells, DU 145 cells, MCF-7 cells, PC-3 cells Positive IHC detected in: rat stomach tissue, human breast cancer tissue, human colon cancer tissue, human liver cancer tissue, human oesophagus cancer tissue, human pancreas cancer tissue, human prostate cancer tissue, human testis tissue, mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-87 MG cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The Rab27 GTPase subfamily consists of two closely related homologs, Rab27a and Rab27b. Northern blot analysis revealed that Rab27b is expressed significantly only in testis, in which the predominant transcript was 1.4 kb in size. An 8-kb mRNA of unknown origin was detected in many tissues. Rab27b is associated with tubulovesicle membranes in the parietal cell and Rab27b may play a role in stimulation-associated membrane recruitment and gastric acid secretion. Rab27b is recently reported as a marker for breast cancer progression. It regulates invasive growth and metastasis in ER-positive breast cancer cell lines, and increased expression is associated with poor prognosis in humans. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4064 Product name: Recombinant human RAB27B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC027474 Sequence: MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC Predict reactive species Full Name: RAB27B, member RAS oncogene family Calculated Molecular Weight: 218 aa, 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC027474 Gene Symbol: RAB27B Gene ID (NCBI): 5874 RRID: AB_2176732 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00194 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924