Iright
BRAND / VENDOR: Proteintech

Proteintech, 13419-1-AP, GSK3A Polyclonal antibody

CATALOG NUMBER: 13419-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GSK3A (13419-1-AP) by Proteintech is a Polyclonal antibody targeting GSK3A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13419-1-AP targets GSK3A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human plasma, mouse liver tissue, MCF-7 cells, PC-3 cells Positive IHC detected in: human prostate cancer tissue, human lung cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Glycogen synthase kinase-3 alpha (GSKA) is one of the two functional isoforms encoded by the GSK gene andacts asa tumor suppressor through its kinase function, targeting many different proteins.What is the molecular weight of GSKA?51 kDa. GSKA is a protein serine kinase composed of 483 amino acids and the catalytic domain shares a highdegree of homology with GSKB, although they are encoded on separate genes.What is the function of GSKA?Constitutively expressed across all tissues, GSKA has a large number of target proteins and is therefore involvedin many different pathways (PMID: 19923896). It was first identified as a regulator of glycogen metabolism, asGSK3A phosphorylates the enzymeglycogen synthase, thereby inhibiting glycogenesis, the conversion of glucoseinto glycogen (PMID: 6249596). It has since been shown to interact with many other proteins and is one of thekinases with most substrates in the cell, with roles in cell cycle progression, proliferation, differentiation, andapoptosis (PMID: 17570479; PMID: 11563964). Typically, GSKA negatively regulates its downstream substrates,often tagging proteins for ubiquitination. It has important roles in the Wnt and PI3K signaling pathways.What is the role of GSK3A in neurodegenerative disease?GSK3A is known to interact with beta-amyloid and tau, proteins that aggregate in areas of the neuronal systemaspart of the pathology of neurodegenerative diseases such as Alzheimer's disease. It has been shown thatGSK3A causes abnormal phosphorylation of the microtubule-binding protein tau in a way thatreflects thepathology of Alzheimer's disease (PMID: 1334849; PMID: 1336152). GSKA has also been shown to processamyloid precursor protein to beta-amyloid, another protein that forms the inclusion bodies, or Lewy bodies,that are one of the hallmarks in Alzheimer's (PMID: 1276154). Another protein involved in the pathology ofAlzheimer's is α-synuclein, which is known to be a substrate for GSK-3β phosphorylation (PMID: 24681994). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4168 Product name: Recombinant human GSK3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 134-483 aa of BC027984 Sequence: YQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLPPLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS Predict reactive species Full Name: glycogen synthase kinase 3 alpha Calculated Molecular Weight: 483 aa, 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC027984 Gene Symbol: GSK3A Gene ID (NCBI): 2931 RRID: AB_2247995 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49840 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924