Proteintech, 13430-1-AP, NDUFV3 Polyclonal antibody

Size: 20ul / 150ul The NDUFV3 (13430-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFV3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 13430-1-AP targets NDUFV3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, human heart tissue, human liver tissue Positive IHC detected in: human placenta tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NDUFV3(NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial) is also named as CI-9kD,Renal carcinoma antigen NY-REN-4 and belongs to the complex I NDUFV3 subunit family.It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4234 Product name: Recombinant human NDUFV3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC033766 Sequence: MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa Calculated Molecular Weight: 108 aa, 12 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC033766 Gene Symbol: NDUFV3 Gene ID (NCBI): 4731 RRID: AB_2282462 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56181 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.