Proteintech, 13432-1-AP, CSRP1 Polyclonal antibody

Size: 20ul / 150ul The CSRP1 (13432-1-AP) by Proteintech is a Polyclonal antibody targeting CSRP1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 13432-1-AP targets CSRP1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human stomach tissue Positive IP detected in: mouse stomach tissue Positive IHC detected in: human normal colon, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CSRP1 (Cysteine and glycine-rich protein 1), designated initially as CRP1, constitutes a cysteine-rich protein derived from placental sources and exhibits a response profile analogous to c-myc. CSRP1 has been recognized as a tumor suppressor in several types of cancers including colorectal cancer, and cholangiocarcinoma (PMID: 37113556). Abnormal expression of CSRP1 was reported within several malignancies such as prostate cancer and acute myeloid leukemia (PMID: 38813484, 40198006). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4236 Product name: Recombinant human CSRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC032493 Sequence: MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE Predict reactive species Full Name: cysteine and glycine-rich protein 1 Calculated Molecular Weight: 193 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC032493 Gene Symbol: CSRP1 Gene ID (NCBI): 1465 RRID: AB_2230180 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21291 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.