Proteintech, 13437-1-AP, OCIAD2 Polyclonal antibody

Size: 20ul / 150ul The OCIAD2 (13437-1-AP) by Proteintech is a Polyclonal antibody targeting OCIAD2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 13437-1-AP targets OCIAD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-251 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4243 Product name: Recombinant human OCIAD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-99 aa of BC032808 Sequence: MASASARGNQDKDAHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRALPFSLVSMLVTQGLVYQGYLAANSRFGSLPKVARTASLPVRNAK Predict reactive species Full Name: OCIA domain containing 2 Calculated Molecular Weight: 99 aa, 11 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC032808 Gene Symbol: OCIAD2 Gene ID (NCBI): 132299 RRID: AB_3085414 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q56VL3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.