Proteintech, 13456-1-AP, MEI1 Polyclonal antibody

Size: 20ul / 150ul The MEI1 (13456-1-AP) by Proteintech is a Polyclonal antibody targeting MEI1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13456-1-AP targets MEI1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: human cervical cancer tissue, human urothelial carcinoma tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MEI1 may play a role in meiosis during spermatogenesis. It is required for normal meiotic chromosome synapsis. MEI1 may be involved in the formation of meiotic double-strand breaks (DSBs) in spermatocytes. This antibody recognizes isoform 1, 2, 3, 5, and 7 of MEI1 gene with MW 141 kDa, 67-72 kDa,49-54 kDa and 26 kDa . Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4253 Product name: Recombinant human MEI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC032248 Sequence: MLALTLAKADSPRTALLCSAWLLTASFSAQQHKGSLQVHQTLSVEMDQVLKALSFPKKKAALLSAAILCFLRTALRQSFSSALVALVPSGAQPLPATKDTVLAPLRMSQVRSLVIGLQNLLVQKDPLLSQACVGCLEALLDYLDARSPDIALHVASQPWNRFLLFTLLDAGENSFLRPEILRLMTLLQSMGHLADHSMAQTLQASLEGLPPSTSSGQPPLQDMLCLGGVAVSLSHIRN Predict reactive species Full Name: meiosis inhibitor 1 Calculated Molecular Weight: 894 aa, 99 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC032248 Gene Symbol: MEI1 Gene ID (NCBI): 150365 RRID: AB_2877951 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5TIA1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.