Iright
BRAND / VENDOR: Proteintech

Proteintech, 13464-1-AP, CABLES1 Polyclonal antibody

CATALOG NUMBER: 13464-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CABLES1 (13464-1-AP) by Proteintech is a Polyclonal antibody targeting CABLES1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 13464-1-AP targets CABLES1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 205 cells, HT-29 cells, SH-SY5Y cells Positive IHC detected in: human colon tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CDK5 and ABL1 enzyme substrate 1 (CABLES1) is a novel Cdk2, Cdk3, and Cdk5 binding protein, which acts as a link between the Cdks and nonreceptor tyrosine kinases and regulates the activity of Cdks by enhancing their Y15 phosphorylation. CABLES1 is a candidate tumor suppressor that negatively regulates cell growth by inhibiting cyclin-dependent kinases. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4251 Product name: Recombinant human CABLES1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-368 aa of BC037218 Sequence: SQRSSLETLEDIEENAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSIFSVLPYRDSTQVGDLKLDGGRQSTGAVSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGARRNTIDSTSSFSQFRNLSHRSLSIGRASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGKHKRVLIFPSYMTTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRRELIAFEFPVLVALEFALHLPEHEVMPHYRRLVQSS Predict reactive species Full Name: Cdk5 and Abl enzyme substrate 1 Calculated Molecular Weight: 568 aa, 63 kDa Observed Molecular Weight: 68 kDa, 42 kDa GenBank Accession Number: BC037218 Gene Symbol: CABLES1 Gene ID (NCBI): 91768 RRID: AB_3669163 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDN4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924