Iright
BRAND / VENDOR: Proteintech

Proteintech, 13474-1-AP, Cryptochrome 1 Polyclonal antibody

CATALOG NUMBER: 13474-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Cryptochrome 1 (13474-1-AP) by Proteintech is a Polyclonal antibody targeting Cryptochrome 1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 13474-1-AP targets Cryptochrome 1 in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Y79 cells, mouse liver tissue, rat liver tissue Positive IHC detected in: mouse brain tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, MCF-7 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Cryptochrome circadian clock 1 (CRY1) is a flavin adenine dinucleotide-binding protein with MW of 66 kDa. CRY1 is a key component of the circadian core oscillator complex, which regulates the circadian clock. CRY1 predominantly displays evening-time expression and serves as a strong repressor of morning-time elements (E box/E-prime box) when bound to the BMAL1 (ARNTL; 602550)/CLOCK (601851) complex (PubMed: 21236481). This antibody can recognize CRY1 and CRY2 due to the high homology. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4270 Product name: Recombinant human CRY1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 236-586 aa of BC030519 Sequence: RPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN Predict reactive species Full Name: cryptochrome 1 (photolyase-like) Calculated Molecular Weight: 586 aa, 66 kDa Observed Molecular Weight: 60-66 kDa GenBank Accession Number: BC030519 Gene Symbol: CRY1 Gene ID (NCBI): 1407 RRID: AB_10697652 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16526 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924