Iright
BRAND / VENDOR: Proteintech

Proteintech, 13482-1-AP, PPP2CA Polyclonal antibody

CATALOG NUMBER: 13482-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PPP2CA (13482-1-AP) by Proteintech is a Polyclonal antibody targeting PPP2CA in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 13482-1-AP targets PPP2CA in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, human liver tissue, Jurkat cells, MCF-7 cells Positive IP detected in: Jurkat cells Positive IHC detected in: mouse liver tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information PPP2CA, also named as RP-C and PP2A-alpha, belongs to the PPP phosphatase family and PP-1 subfamily. PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. PP2A activity was modestly decreased in AML patients harboring C-KIT/WT.PP2A is a target for C-KIT/TKD and implicated the potential efficacy of therapies targeting PP2A in such AML in future. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4294 Product name: Recombinant human PPP2CA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-309 aa of BC031696 Sequence: MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL Predict reactive species Full Name: protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform Calculated Molecular Weight: 309 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC031696 Gene Symbol: PPP2CA Gene ID (NCBI): 5515 RRID: AB_2169485 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P67775 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924