Proteintech, 13501-1-AP, GPX7 Polyclonal antibody

Size: 20ul / 150ul The GPX7 (13501-1-AP) by Proteintech is a Polyclonal antibody targeting GPX7 in WB, IHC, ELISA applications with reactivity to human samples 13501-1-AP targets GPX7 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human liver tissue, human placenta tissue, human brain tissue, Transfected HEK-293 cells Positive IHC detected in: human liver cancer tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPX7(Glutathione peroxidase 7) is also named as CL683,GSHPx-7 and belongs to the glutathione peroxidase family.It shares approximately 45% amino acid sequence with other GPX family members.Because GPX7 expression protected cells from acidic bile acidinduced DNA damage, it may protect oesophageal epithelial cells from acidic bile acid-induced apoptosis(PMID:22157330). This antibody can ve detected as 18-21kDa due to signal peptide splicing. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4328 Product name: Recombinant human GPX7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 58-187 aa of BC032788 Sequence: GFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL Predict reactive species Full Name: glutathione peroxidase 7 Calculated Molecular Weight: 187 aa, 21 kDa Observed Molecular Weight: 18-21 kDa GenBank Accession Number: BC032788 Gene Symbol: GPX7 Gene ID (NCBI): 2882 RRID: AB_2112560 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96SL4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.