Proteintech, 13503-1-AP, REX1 Polyclonal antibody

Size: 20ul / 150ul The REX1 (13503-1-AP) by Proteintech is a Polyclonal antibody targeting REX1 in IF/ICC, ELISA applications with reactivity to human samples 13503-1-AP targets REX1 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: human embronic stem cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information REXO1, also named as EloA-BP1, ELOABP1, KIAA1138 and TCEB3BP1, is transcription elongation factor B polypeptide 3-binding protein 1. REXO1 did not affect either the rate of transcription elongation by RNA polymerase II or the transcriptional activity of TCEB3 in vitro. This gene is different to the REX1 which is an embryo stem cell marker. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4334 Product name: Recombinant human REXO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 865-1221 aa of BC032244 Sequence: VNTLKKLRGLAPSAVPGLSKTGGRRVVSHEVVLGGRLAAKTSFSLSRPSSPRVEDLKGAALYSRLREYLLTQDQLKENGYPFPHPERPGGAIIFTAEEKRPKDSSCRTCCRCGTEYLVSSSGRCIRDEECYYHWGRLRRNRVAGGWETQYMCCSAAAGSVGCQVAKQHVQDGRKERLEGFVKTFEKELSGDTHPGIYALDCEMSYTTYGLELTRVTVVDTDVHVVYDTFVKPDNEIVDYNTRFSGVTEADLADTSVTLRDVQAVLLSMFSADTILIGHSLESDLLALKVIHSTVVDTSVLFPHRLGLPYKRSLRNLMADYLRQIIQDNVDGHSSSEDAGACMHLVIWKVREDAKTKR Predict reactive species Full Name: REX1, RNA exonuclease 1 homolog (S. cerevisiae) Calculated Molecular Weight: 1221 aa, 132 kDa Observed Molecular Weight: 132 kDa GenBank Accession Number: BC032244 Gene Symbol: REX1 Gene ID (NCBI): 57455 RRID: AB_10643391 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N1G1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.