Iright
BRAND / VENDOR: Proteintech

Proteintech, 13508-1-AP, MTPN Polyclonal antibody

CATALOG NUMBER: 13508-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MTPN (13508-1-AP) by Proteintech is a Polyclonal antibody targeting MTPN in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13508-1-AP targets MTPN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, human brain tissue, HeLa cells, Jurkat cells Positive IHC detected in: human normal colon, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Myotrophin (MTPN) is a ubiquitously expressed 12 kDa cytoplamic protein that was first isolated from the hearts of spontaneously hypertensive rats. Protein sequence analysis revealed that MTPN was composed of 118 amino acids and was occupied by two and a half internal 33 amino acid ankyrin repeats. MTPN stimulates protein synthesis and increases the expression of a number of cardiac marker genes (such as atrial natriuretic factor and b-myosin heavy chain) in cardiomyocytes leading to hypertrophy. In skeletal muscle, MTPN is also a positive growth factor in promoting skeletal muscle growth. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4419 Product name: Recombinant human MTPN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC028093 Sequence: MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ Predict reactive species Full Name: myotrophin Calculated Molecular Weight: 118 aa, 13 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC028093 Gene Symbol: MTPN Gene ID (NCBI): 136319 RRID: AB_2148129 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P58546 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924