Iright
BRAND / VENDOR: Proteintech

Proteintech, 13509-1-AP, p115, USO1 Polyclonal antibody

CATALOG NUMBER: 13509-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The p115, USO1 (13509-1-AP) by Proteintech is a Polyclonal antibody targeting p115, USO1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13509-1-AP targets p115, USO1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse testis tissue, mouse thymus tissue, HeLa cells, human brain tissue, SH-SY5Y cells, HepG2 cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information p115, also known as USO1, TAP (transcytosis-associated protein) or VDP (vesicle docking protein) is a general vesicular transport factor and plays an important role at different steps of vesicular transport. It is a 962-residue peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase (PMID: 9478999). p115 forms stable homodimers (PMID: 19247479). Rab1 recruits p115 to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where p115 interacts directly with a select set of SNARE proteins (PMID: 10903204). p115 is required for intra-Golgi transport, and also functions in endoplasmic reticulum to Golgi trafficking, Golgi biogenesis and exocytotic transport (PMID: 19247479). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4431 Product name: Recombinant human p115, USO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 660-961 aa of BC032654 Sequence: EQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI Predict reactive species Full Name: USO1 homolog, vesicle docking protein (yeast) Calculated Molecular Weight: 962 aa, 108 kDa Observed Molecular Weight: 115 kDa GenBank Accession Number: BC032654 Gene Symbol: USO1 Gene ID (NCBI): 8615 RRID: AB_2257094 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60763 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924