Iright
BRAND / VENDOR: Proteintech

Proteintech, 13512-1-AP, SNRPB2 Polyclonal antibody

CATALOG NUMBER: 13512-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul SNRPB2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA 13512-1-AP targets SNRPB2 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue, human kidney tissue, human liver tissue, mouse liver tissue, mouse lung tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information U2 small nuclear ribonucleoprotein B''(SNRPB2) is part of the U2 RNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. Only in presence of the U2A' protein, SNRPB2 binds stem loop IV of U2 snRNA. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4436 Product name: Recombinant human SNRPB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC036737 Sequence: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK Predict reactive species Full Name: small nuclear ribonucleoprotein polypeptide B'' Calculated Molecular Weight: 225 aa, 26, 5 kDa Observed Molecular Weight: 25-31 kDa GenBank Accession Number: BC036737 Gene Symbol: SNRPB2 Gene ID (NCBI): 6629 RRID: AB_2302390 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08579 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924