Proteintech, 13536-1-AP, FSCN3 Polyclonal antibody

Size: 20ul / 150ul The FSCN3 (13536-1-AP) by Proteintech is a Polyclonal antibody targeting FSCN3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13536-1-AP targets FSCN3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4459 Product name: Recombinant human FSCN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 142-498 aa of BC035606 Sequence: LHVHVILYSPIHRCYARADPTMGRIWVDAAVPCLEECGFLLHFRDGCYHLETSTHHFLSHVDRLFSQPSSQTAFHMQVRPGGLVALCDGEGGMLYPQGTHLLLGMGCNPMRGEEWFILQHCPTWVSLRSKTGRFISVIYDGEVRAASERLNRMSLFQFECDSESPTVQLRSANGYYLSQRRHRAVMADGHPLESDTFFRMHWNCGRIILQSCRGRFLGIAPNSLLMANVILPGPNEEFGILFANRSFLVLRGRYGYVGSSSGHDLIQCNQDQPDRIHLLPCRPGIYHFQAQGGSFWSITSFGTFRPWGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWEF Predict reactive species Full Name: fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotus purpuratus) Calculated Molecular Weight: 498 aa, 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC035606 Gene Symbol: FSCN3 Gene ID (NCBI): 29999 RRID: AB_2106517 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQT6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.