Iright
BRAND / VENDOR: Proteintech

Proteintech, 13544-1-AP, PDSS2 Polyclonal antibody

CATALOG NUMBER: 13544-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PDSS2 (13544-1-AP) by Proteintech is a Polyclonal antibody targeting PDSS2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13544-1-AP targets PDSS2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SGC-7901 cells, A375 cells Positive IHC detected in: human kidney tissue, human liver cancer tissue, mouse liver tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information PDSS2, also named as C6orf210, is required for the synthesis of coenzyme Q10 (CoQ10), which is synthesized in the mitochondrial inner membrane and plays a vital role in the mitochondrial respiratory chain, pyrimidine nucleoside biosynthesis, and modulation of apoptosis (PMID:25330808). An increasing body of evidence suggests that PDSS2 is a tumor suppressor gene in certain cancers, such as melanoma, gastric cancer and non-small cell lung cancer. Besides, PDSS2 could be used as a prognostic biomarker for HCC (PMID:25780306). PDSS2 has 2 isoforms with MW of 44 kDa and 27 kDa while 13544-1-AP antibody detects the bands around 27-30 kDa and 44-47 kDa in SDS-PAGE. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4487 Product name: Recombinant human PDSS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-242 aa of BC039906 Sequence: MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITDDI Predict reactive species Full Name: prenyl (decaprenyl) diphosphate synthase, subunit 2 Calculated Molecular Weight: 399 aa, 44 kDa Observed Molecular Weight: 27-30 kDa, 44-47 kDa GenBank Accession Number: BC039906 Gene Symbol: PDSS2 Gene ID (NCBI): 57107 RRID: AB_10598311 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86YH6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924