Proteintech, 13546-1-AP, ST3GAL4 Polyclonal antibody

Size: 20ul / 150ul The ST3GAL4 (13546-1-AP) by Proteintech is a Polyclonal antibody targeting ST3GAL4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 13546-1-AP targets ST3GAL4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HCT 116 cells, HepG2 cells, MCF-7 cells, MDA-MB-231 cells Positive IHC detected in: mouse ovary tissue, human skin tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ST3GAL4, also known as CGS23, NANTA3 and SIAT4C, is a member of the glycosyltransferase 29 family. ST3GAL4 protein exists in multiple splice variants and is frequently modified by glycosylation. ST3GAL4 is expressed uniformly in tissues and organs during all stages of development, and the subcellular localization is currently not clear. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3665 Product name: Recombinant human ST3GAL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-333 aa of BC010645 Sequence: MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF Predict reactive species Full Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 4 Calculated Molecular Weight: 333 aa, 38 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC010645 Gene Symbol: ST3GAL4 Gene ID (NCBI): 6484 RRID: AB_10597402 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q11206 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.