Proteintech, 13552-1-AP, COG7 Polyclonal antibody

Size: 20ul / 150ul The COG7 (13552-1-AP) by Proteintech is a Polyclonal antibody targeting COG7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13552-1-AP targets COG7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Y79 cells, HeLa cells Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4335 Product name: Recombinant human COG7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 419-770 aa of BC037563 Sequence: CGLLSALKSLFAKYVSDFTSTLQSIRKKCKLDHIPPNSLFQEDWTAFQNSIRIIATCGELLRHCGDFEQQLANRILSTAGKYLSDSCSPRSLAGFQESILTDKKNSAKNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSNHNLLAAPRAALTRLNQQAHQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLPLNLEPFVTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDAILQIPELSPHSAKQLATDIDYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQVSKGLPRRLATTVATMRSVNY Predict reactive species Full Name: component of oligomeric golgi complex 7 Calculated Molecular Weight: 770 aa, 86 kDa Observed Molecular Weight: 86 kDa GenBank Accession Number: BC037563 Gene Symbol: COG7 Gene ID (NCBI): 91949 RRID: AB_2229608 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P83436 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.