Iright
BRAND / VENDOR: Proteintech

Proteintech, 13594-1-AP, SLC22A2 Polyclonal antibody

CATALOG NUMBER: 13594-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC22A2 (13594-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A2 in WB, ELISA applications with reactivity to human, mouse, rat samples 13594-1-AP targets SLC22A2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, HEK-293 cells, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information SLC22A2, also named as OCT2, belongs to the major facilitator (TC 2.A.1) superfamily and Organic cation transporter (TC 2.A.1.19) family. The SLC22A2 gene encodes for the organic cation transporter 2 (OCT2) protein which acts as a renal uptake transporter. Human OCT2 (hOCT2) is expressed on the basolateral side of the proximal tubule cells and plays a crucial role in the disposition and renal clearance of cationic drugs and endogenous compounds (PMID: 35143948). SLC22A2 has 3 isoforms with the molecular mass of 27, 54 and 63 kDa. Sometimes higher molecular weight around 70 kDa can also be observed, which may be a modified variant of SLC22A2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4500 Product name: Recombinant human SLC22A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 39-150 aa of BC039899 Sequence: GIVFLGFTPDHRCRSPGVAELSLRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLGPCRDGWVYETPGSSIVTEFNLVCANSWMLD Predict reactive species Full Name: solute carrier family 22 (organic cation transporter), member 2 Calculated Molecular Weight: 555 aa, 63 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC039899 Gene Symbol: SLC22A2 Gene ID (NCBI): 6582 RRID: AB_2239467 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15244 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924