Iright
BRAND / VENDOR: Proteintech

Proteintech, 13610-1-AP, REG3A Polyclonal antibody

CATALOG NUMBER: 13610-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The REG3A (13610-1-AP) by Proteintech is a Polyclonal antibody targeting REG3A in WB, ELISA applications with reactivity to human, mouse, rat samples 13610-1-AP targets REG3A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse small intestine tissue, rat small intestine tisue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Regenerating family member 3 alpha (Reg3A) encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. During pancreatic inflammation, the secretion of Reg3A by inflamed acinar cells is sensitively and markedly upregulated. The mature protein also functions as an antimicrobial protein with antibacterial activity. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4508 Product name: Recombinant human REG3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC036776 Sequence: MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD Predict reactive species Full Name: regenerating islet-derived 3 alpha Calculated Molecular Weight: 175 aa, 19 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC036776 Gene Symbol: REG3A Gene ID (NCBI): 5068 RRID: AB_3669166 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q06141 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924