Iright
BRAND / VENDOR: Proteintech

Proteintech, 13621-1-AP, ADAT2 Polyclonal antibody

CATALOG NUMBER: 13621-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ADAT2 (13621-1-AP) by Proteintech is a Polyclonal antibody targeting ADAT2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13621-1-AP targets ADAT2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, mouse brain tissue, mouse pancreas tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human hepatocirrhosis tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information ADAT2(tRNA-specific adenosine deaminase 2) is also named as DEADC1 and Belongs to the cytidine and deoxycytidylate deaminase family. It is a 24-kDa molecular mass protein that harbors all the conserved motifs required for deamination. ADAT2 and ADAT3 can function as a heterodimer which catalyses inosine formation at the wobble position (position 34) in eukaryotic tRNAs(PMID:12457566). It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4529 Product name: Recombinant human ADAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-193 aa of BC037955 Sequence: HMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS Predict reactive species Full Name: adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae) Calculated Molecular Weight: 191 aa, 21 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC037955 Gene Symbol: ADAT2 Gene ID (NCBI): 134637 RRID: AB_10642142 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z6V5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924