Proteintech, 13629-1-AP, RALA Polyclonal antibody

Size: 20ul / 150ul The RALA (13629-1-AP) by Proteintech is a Polyclonal antibody targeting RALA in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13629-1-AP targets RALA in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue, fetal human brain tissue, MCF-7 cells, HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RALA belongs to the small GTPase superfamily. Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. RALA plays a role in the early stages of cytokinesis and is required to tether the exocyst to the cytokinetic furrow. The RALA-exocyst complex regulates integrin-dependent membrane raft exocytosis and growth signaling. As an effector of the proto-oncogene Ras, it play an important role in the molecular pathology of human malignancies. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4547 Product name: Recombinant human RALA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC039858 Sequence: MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL Predict reactive species Full Name: v-ral simian leukemia viral oncogene homolog A (ras related) Calculated Molecular Weight: 206 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC039858 Gene Symbol: RALA Gene ID (NCBI): 5898 RRID: AB_2269251 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11233 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.