Iright
BRAND / VENDOR: Proteintech

Proteintech, 13630-1-AP, CREB3L4 Polyclonal antibody

CATALOG NUMBER: 13630-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CREB3L4 (13630-1-AP) by Proteintech is a Polyclonal antibody targeting CREB3L4 in WB, IF/ICC, ELISA applications with reactivity to human samples 13630-1-AP targets CREB3L4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HL-60 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CREB3L4 (cAMP responsive element binding protein 3-like 4), also named as AIBZIP, CREB4 and ATCE1, is a member of the CREB/ATF transcription factor family. CREB3L4 may play a role in the unfolded protein response, characterized by their regulation of gene expression through the cAMP-responsive element(PMID: 22829733). CREB3L4 is highly expressed in multiple human cancers, such as human breast carcinoma, prostate cancer(PMID: 32026099, PMID: 28338058). The molecular weight of CREB3L4 is 43 kDa and 55 kDa precursor was reported. Due to glycosylation, CREB3L4 can be observed with molecular weights of 35 and 41 kDa (PMID: 25412305, 15938716). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4548 Product name: Recombinant human CREB3L4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC038962 Sequence: MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAGALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAG Predict reactive species Full Name: cAMP responsive element binding protein 3-like 4 Calculated Molecular Weight: 395 aa, 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC038962 Gene Symbol: CREB3L4 Gene ID (NCBI): 148327 RRID: AB_2276550 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TEY5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924