Proteintech, 13637-1-AP, TULP3 Polyclonal antibody

Size: 20ul / 150ul The TULP3 (13637-1-AP) by Proteintech is a Polyclonal antibody targeting TULP3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13637-1-AP targets TULP3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, SH-SY5Y cells, HeLa cells, SK-N-SH cells Positive IP detected in: SH-SY5Y cells Positive IHC detected in: human ovary cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The tubby-like protein 3 (TULP3) has been identified as a member of tubby and tubby-like proteins (TULPs) that plays an important role in maintenance and function of neuronal cells during development and post-differentiation. Tulp3 gene is essential for embryonic development in mice. Recently TULP3 has been reported to bind to the IFT (intraflagellar transport)-A complex and promote trafficking of G protein-coupled receptors into primary cilia, which is implicated in regulating neuronal function. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4570 Product name: Recombinant human TULP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-442 aa of BC032587 Sequence: DEVHAPSVSSSVVEEDAENTVDTASKPGLQERLQKHDISESVNFDEETDGISQSACLERPNSASSQNSTDTGTSGSATAAQPADNLLGDIDYLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSSFDSKLACE Predict reactive species Full Name: tubby like protein 3 Calculated Molecular Weight: 442 aa, 50 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC032587 Gene Symbol: TULP3 Gene ID (NCBI): 7289 RRID: AB_2211547 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75386 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.