Iright
BRAND / VENDOR: Proteintech

Proteintech, 13651-1-AP, PRAM1 Polyclonal antibody

CATALOG NUMBER: 13651-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PRAM1 (13651-1-AP) by Proteintech is a Polyclonal antibody targeting PRAM1 in WB, ELISA applications with reactivity to human samples 13651-1-AP targets PRAM1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-937 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information PRAM1, also named as PML-RARA-regulated adapter molecule 1, is a 718 amino acid protein, which contains 1 SH3 domain. PRAM1 is expressed in peripheral blood leukocytes and bone marrow. It is not expressed in non hematopoietic tissues except in lung. PRAM1 may be involved in myeloid differentiation and integrin signaling in neutrophils. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4162 Product name: Recombinant human PRAM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC028012 Sequence: MAHHLPAAMENHQDFRSIKAKFQASQPEPSDLPKKPPKPEFGKLKKFSQPELSEHPKKAPLPEFGAVSLKPPPPEVTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPSKLELSDLSKKFPQLGATPFPRKPLQPEVGEAPLKASLPEPGAPARKPLQPDELSHPARPPSEPKSGAFPRKLWQPEAGEATPRSPQPELSTFPKKPAQPEFNVYPKKPPQPQVGGLPKKSVPQPEFSEAAQTPLWKPQSSEPKRDSSAFPKKASQPPLSDFPKKPPQPELGDLTRTSSE Predict reactive species Full Name: PML-RARA regulated adaptor molecule 1 Calculated Molecular Weight: 718 aa, 79 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC028012 Gene Symbol: PRAM1 Gene ID (NCBI): 84106 RRID: AB_2877964 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96QH2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924