Iright
BRAND / VENDOR: Proteintech

Proteintech, 13660-1-AP, CDC14A Polyclonal antibody

CATALOG NUMBER: 13660-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CDC14A (13660-1-AP) by Proteintech is a Polyclonal antibody targeting CDC14A in WB, ELISA applications with reactivity to human, mouse, rat samples 13660-1-AP targets CDC14A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human heart tissue, human brain tissue, HeLa cells, COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4556 Product name: Recombinant human CDC14A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-191 aa of BC038979 Sequence: MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYEVILFTPLKPTFLISKSIM Predict reactive species Full Name: CDC14 cell division cycle 14 homolog A (S. cerevisiae) Calculated Molecular Weight: 594 aa, 66 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC038979 Gene Symbol: CDC14A Gene ID (NCBI): 8556 RRID: AB_2260218 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNH5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924