Iright
BRAND / VENDOR: Proteintech

Proteintech, 13708-1-AP, LARP1 Polyclonal antibody

CATALOG NUMBER: 13708-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LARP1 (13708-1-AP) by Proteintech is a Polyclonal antibody targeting LARP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, drosophila samples 13708-1-AP targets LARP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, drosophila samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, HepG2 cells, mouse heart tissue, mouse testis tissue, mouse brain tissue Positive IHC detected in: human ovary cancer tissue, human liver cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:800-1:3200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LARP1 is a widely expressed RNA-binding protein. LARP1 can participate in the cellular stress response by regulating the translation of TOP class mRNA. Specification Tested Reactivity: human, mouse, rat, drosophila Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4645 Product name: Recombinant human LARP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-283 aa of BC033856 Sequence: MPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK Predict reactive species Full Name: La ribonucleoprotein domain family, member 1 Calculated Molecular Weight: 1096 aa, 124 kDa Observed Molecular Weight: 140-150 kDa GenBank Accession Number: BC033856 Gene Symbol: LARP1 Gene ID (NCBI): 23367 RRID: AB_2296670 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PKG0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924